Leptin antibody

Catalog No. ABIN4951605

Product Details anti-Leptin Antibody

Target: Leptin (LEP)

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Leptin antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purification: Antigen affinity

Immunogen: Amino acids KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH of mouse Leptin were used as the immunogen for the Leptin antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Leptin antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Leptin antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Leptin

Target: Leptin (LEP)

Alternative Name: Leptin / LEP (LEP Products)

Synonyms: ob antibody, obese antibody, LEPD antibody, OB antibody, OBS antibody, leptin antibody, Lep antibody, LEP antibody, lep antibody

Background: Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

UniProt: P41160

Pathways: JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process