LIMK2 antibody

Catalog No. ABIN4951617

Product Details anti-LIMK2 Antibody

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LIMK2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Antigen affinity

Immunogen: Amino acids KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD of human LIM Kinase 2 were used as the immunogen for the LIMK2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the LIMK2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,ELISA : 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the LIMK2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for LIMK2

Target: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Alternative Name: LIM Kinase 2 / LIMK2 (LIMK2 Products)

Synonyms: xlimk2 antibody, zgc:91990 antibody, wu:fa97c09 antibody, wu:fk73e11 antibody, LIMK2 antibody, Limk2b antibody, Link2 antibody, LIMK antibody, 9430059K01 antibody, A930024P04Rik antibody, C85310 antibody, Limk2a antibody, LIM domain kinase 2 L homeolog antibody, LIM domain kinase 2 antibody, LIM motif-containing protein kinase 2 antibody, limk2.L antibody, limk2 antibody, LIMK2 antibody, Limk2 antibody

Background: LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

UniProt: P53671