PDPK1 antibody

Catalog No. ABIN4952109

Product Details anti-PDPK1 Antibody

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDPK1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunohistochemistry (Frozen Sections) (IHC (fro))

Purification: Antigen affinity

Immunogen: Amino acids YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ of human PDPK1 were used as the immunogen for the PDPK1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PDPK1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,IHC (Frozen): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PDPK1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PDPK1

Target: PDPK1 (3-phosphoinositide Dependent Protein Kinase-1 (PDPK1))

Alternative Name: PDPK1 / 3-phosphoinositide-dependent protein kinase 1 (PDPK1 Products)

Synonyms: pdpk1 antibody, MGC82080 antibody, PDK1 antibody, PDPK2 antibody, PRO0461 antibody, Pdk1 antibody, zgc:153787 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1 antibody, ATPDK1 antibody, AtPDK1 antibody, T32M21.110 antibody, T32M21_110 antibody, zgc:77318 antibody, 3-phosphoinositide dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1 L homeolog antibody, 3-phosphoinositide dependent protein kinase-1 antibody, 3-phosphoinositide dependent protein kinase 1a antibody, 3-phosphoinositide-dependent protein kinase 1 antibody, 3'-phosphoinositide-dependent protein kinase 1 antibody, 3-phosphoinositide dependent protein kinase 1b antibody, PDPK1 antibody, pdpk1.L antibody, pdpk1 antibody, Pdpk1 antibody, pdpk1a antibody, LOC100380750 antibody, pdk-1 antibody, PDK1 antibody, pdpk1b antibody

Background: 3-phosphoinositide dependent protein kinase-1 is a protein which in humans is encoded by the PDPK1 gene. PDPK1 is a master kinase, which is crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, SGK. An important role for PDPK1 is in the signalling pathways activated by several growth factors and hormones including insulin signaling. Mice lacking PDPK1 die during early embryonic development, indicating that this enzyme is critical for transmitting the growth-promoting signals necessary for normal mammalian development.

UniProt: O15530

Pathways: PI3K-Akt Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals