PRKAB2 antibody

Catalog No. ABIN4952261

Product Details anti-PRKAB2 Antibody

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAB2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the PRKAB2 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the PRKAB2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PRKAB2

Target: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Alternative Name: AMPK beta 2 / PRKAB2 (PRKAB2 Products)

Synonyms: prkab2 antibody, MGC64365 antibody, PRKAB2 antibody, DKFZp469M1118 antibody, 5730553K21Rik antibody, AW049591 antibody, BB124140 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog antibody, protein kinase AMP-activated non-catalytic subunit beta 2 antibody, protein kinase, AMP-activated, beta 2 non-catalytic subunit antibody, prkab2.L antibody, PRKAB2 antibody, prkab2 antibody, Prkab2 antibody

Background: 5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.

UniProt: O43741

Pathways: AMPK Signaling, Warburg Effect