MAPK13 antibody

Catalog No. ABIN4952463

Product Details anti-MAPK13 Antibody

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAPK13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids KLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL of human MAPK13/SAPK4 were used as the immunogen for the SAPK4 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SAPK4 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SAPK4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for MAPK13

Target: MAPK13 (Mitogen-Activated Protein Kinase 13 (MAPK13))

Alternative Name: MAPK13 / SAPK4 (MAPK13 Products)

Synonyms: F24B9.3 antibody, F24B9_3 antibody, MAPK 13 antibody, MAPK-13 antibody, PRKM13 antibody, SAPK4 antibody, p38delta antibody, Serk4 antibody, Prkm13 antibody, sapk4 antibody, prkm13 antibody, Protein kinase superfamily protein antibody, mitogen-activated protein kinase 13 antibody, mitogen activated protein kinase 13 antibody, ATMPK13 antibody, MAPK13 antibody, Mapk13 antibody, mapk13 antibody

Background: MAPK13 (Mitogen-Activated Protein Kinase 13), also called p38-DELTA or Stress-Activated Protein Kinase 4 (SAPK4), is an enzyme that in humans is encoded by the MAPK13 gene. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

UniProt: O15264

Pathways: MAPK Signaling, Neurotrophin Signaling Pathway, Hepatitis C, BCR Signaling, S100 Proteins