SLC12A1 antibody

Catalog No. ABIN4952575

Product Details anti-SLC12A1 Antibody

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC12A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity

Immunogen: Amino acids DEAQKRLRISFRPGNQECYDNFLQSGETAKTD of human SLC12A1 were used as the immunogen for the SLC12A1 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SLC12A1 antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SLC12A1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SLC12A1

Target: SLC12A1 (Solute Carrier Family 12 (Sodium/potassium/chloride Transporters), Member 1 (SLC12A1))

Alternative Name: NKCC2 / SLC12A1 (SLC12A1 Products)

Synonyms: slc12a1 antibody, SLC12A1 antibody, DKFZp469A2020 antibody, BSC1 antibody, NKCC2 antibody, Nkcc2 antibody, AI788571 antibody, D630042G03Rik antibody, mBSC1 antibody, urehr3 antibody, si:ch211-220f12.1 antibody, solute carrier family 12 member 1 antibody, solute carrier family 12, member 1 antibody, si:ch211-220f12.1 antibody, SLC12A1 antibody, Slc12a1 antibody

Background: Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney. This gene is mapped to 15q21.1. This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa. It plays a key role in concentrating urine and accounts for most of the NaCl resorption. It is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. This gene plays a vital role in the regulation of ionic balance and cell volume.

UniProt: Q13621