ANGPTL4 antibody (C-Term)

Catalog No. ABIN5518734

Product Details anti-ANGPTL4 Antibody

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Binding Specificity: AA 369-406, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANGPTL4 antibody is un-conjugated

Application: Western Blotting (WB), ELISA

Purpose: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.

Sequence: QQRQKLKKGI FWKTWRGRYY PLQATTMLIQ PMAAEAAS

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection. Tested with WB, ELISA in Human.
Gene Name: angiopoietin-like 4
Protein Name: Angiopoietin-related protein 4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for ANGPTL4

Target: ANGPTL4 (Angiopoietin-Like 4 (ANGPTL4))

Alternative Name: ANGPTL4 (ANGPTL4 Products)

Synonyms: ANGPTL2 antibody, ARP4 antibody, FIAF antibody, HFARP antibody, NL2 antibody, PGAR antibody, pp1158 antibody, Arp4 antibody, Bk89 antibody, Fiaf antibody, Hfarp antibody, Ng27 antibody, Pgar antibody, Pgarg antibody, Pp1158 antibody, ANGPTL4 antibody, fiaf antibody, im:7144703 antibody, si:rp71-39b20.7 antibody, angiopoietin like 4 antibody, angiopoietin-like 4 antibody, ANGPTL4 antibody, Angptl4 antibody, angptl4 antibody

Background: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

Synonyms: Angiopoietin like 4 | Angiopoietin related protein 4 | Angiopoietinlike 4 | angiopoietin-like 4 | Angiopoietin-like 4 | Angiopoietin-like protein 4 | Angiopoietinrelated protein 4 | ANGL4 | angptl 4 | ANGPTL2 | ANGPTL4 | ARP4 | PGAR | HFARP | pp1158 | PSEC0166 | TGQTL | Q9BY76

Gene ID: 51129

Pathways: Regulation of Lipid Metabolism by PPARalpha