Endoglin antibody (Middle Region)

Catalog No. ABIN5518816

Product Details anti-Endoglin Antibody

Target: Endoglin (ENG)

Binding Specificity: AA 258-297, Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Endoglin antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.

Sequence: YVSWLIDANH NMQIWTTGEY SFKIFPEKNI RGFKLPDTPQ

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: endoglin
Protein Name: Endoglin

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ), different from the related mouse sequence by twelve amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

References for anti-Endoglin antibody (ABIN5518816)

Ding, Chang, Niu, Dai, Geng, Li, Guo, Xu: "Overexpression of transcription factor Foxa2 and Hnf1α induced rat bone mesenchymal stem cells into hepatocytes." in: Cytotechnology, Vol. 68, Issue 5, pp. 2037-47, (2016) (PubMed).

Zhang, Shang, Hao, Zheng, Li, Liang, Cui, Liu: "Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats." in: American journal of translational research, Vol. 7, Issue 11, pp. 2176-86, (2016) (PubMed).

Yuan, Liu, Li, Li, Sun, Xu, Man, Fu: "Effects of BMSCs interactions with adventitial fibroblasts in transdifferentiation and ultrastructure processes." in: International journal of clinical and experimental pathology, Vol. 7, Issue 7, pp. 3957-65, (2015) (PubMed).

Li, Zeng, Qi, Tang, Zhang, Wu, Liang, Shi, Liu, Zhang: "Xenotransplantation of human adipose-derived stem cells in zebrafish embryos." in: PLoS ONE, Vol. 10, Issue 4, pp. e0123264, (2015) (PubMed).

Liu, Feng, Dong, Yang, Li, Chen, Zhang, Wang, Zhou, Zhao: "Administration of BMSCs with muscone in rats with gentamicin-induced AKI improves their therapeutic efficacy." in: PLoS ONE, Vol. 9, Issue 5, pp. e97123, (2014) (PubMed).

Dai, Li, Zhou, Chen, Chen, Xiao: "Genistein promotion of osteogenic differentiation through BMP2/SMAD5/RUNX2 signaling." in: International journal of biological sciences, Vol. 9, Issue 10, pp. 1089-98, (2013) (PubMed).

Ren, Ren, Zhao, Wang, Zuo, Yu: "Antitumor activity of endogenous mFlt4 displayed on a T4 phage nanoparticle surface." in: Acta pharmacologica Sinica, Vol. 30, Issue 5, pp. 637-45, (2009) (PubMed).

Gracza: "[Molecular pharmacological investigation of medicinal plant substances. II. Inhibition of acetylcholinesterase by monoterpene derivatives in vitro]." in: Zeitschrift fur Naturforschung. Section C, Biosciences, Vol. 40, Issue 3-4, pp. 151-3, (1985) (PubMed).

Target Details for Endoglin

Target: Endoglin (ENG)

Alternative Name: ENG (ENG Products)

Synonyms: ENG antibody, MGC137842 antibody, DKFZp469D0419 antibody, END antibody, HHT1 antibody, ORW1 antibody, AI528660 antibody, AI662476 antibody, CD105 antibody, S-endoglin antibody, endoglin antibody, ENG antibody, Eng antibody

Background: Endoglin (Osler-Rendu-Weber syndrome 1), CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

Synonyms: Endoglin | CD105 | ENG | END | P17813

Gene ID: 2022

UniProt: P17813