Endoglin antibody (Middle Region)
-
- Target See all Endoglin (ENG) Antibodies
- Endoglin (ENG)
-
Binding Specificity
- AA 258-297, Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Endoglin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- YVSWLIDANH NMQIWTTGEY SFKIFPEKNI RGFKLPDTPQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Endoglin(ENG) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: endoglin
Protein Name: Endoglin - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ), different from the related mouse sequence by twelve amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product ENG Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Overexpression of transcription factor Foxa2 and Hnf1α induced rat bone mesenchymal stem cells into hepatocytes." in: Cytotechnology, Vol. 68, Issue 5, pp. 2037-47, (2016) (PubMed).
: "Effects of human umbilical cord mesenchymal stem cell transplantation combined with minimally invasive hematoma aspiration on intracerebral hemorrhage in rats." in: American journal of translational research, Vol. 7, Issue 11, pp. 2176-86, (2016) (PubMed).
: "Effects of BMSCs interactions with adventitial fibroblasts in transdifferentiation and ultrastructure processes." in: International journal of clinical and experimental pathology, Vol. 7, Issue 7, pp. 3957-65, (2015) (PubMed).
: "Xenotransplantation of human adipose-derived stem cells in zebrafish embryos." in: PLoS ONE, Vol. 10, Issue 4, pp. e0123264, (2015) (PubMed).
: "Administration of BMSCs with muscone in rats with gentamicin-induced AKI improves their therapeutic efficacy." in: PLoS ONE, Vol. 9, Issue 5, pp. e97123, (2014) (PubMed).
: "Genistein promotion of osteogenic differentiation through BMP2/SMAD5/RUNX2 signaling." in: International journal of biological sciences, Vol. 9, Issue 10, pp. 1089-98, (2013) (PubMed).
: "Antitumor activity of endogenous mFlt4 displayed on a T4 phage nanoparticle surface." in: Acta pharmacologica Sinica, Vol. 30, Issue 5, pp. 637-45, (2009) (PubMed).
: "[Molecular pharmacological investigation of medicinal plant substances. II. Inhibition of acetylcholinesterase by monoterpene derivatives in vitro]." in: Zeitschrift fur Naturforschung. Section C, Biosciences, Vol. 40, Issue 3-4, pp. 151-3, (1985) (PubMed).
: "
-
Overexpression of transcription factor Foxa2 and Hnf1α induced rat bone mesenchymal stem cells into hepatocytes." in: Cytotechnology, Vol. 68, Issue 5, pp. 2037-47, (2016) (PubMed).
-
- Target
- Endoglin (ENG)
- Alternative Name
- ENG (ENG Products)
- Synonyms
- ENG antibody, MGC137842 antibody, DKFZp469D0419 antibody, END antibody, HHT1 antibody, ORW1 antibody, AI528660 antibody, AI662476 antibody, CD105 antibody, S-endoglin antibody, endoglin antibody, ENG antibody, Eng antibody
- Background
-
Endoglin (Osler-Rendu-Weber syndrome 1), CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.
Synonyms: Endoglin | CD105 | ENG | END | P17813 - Gene ID
- 2022
- UniProt
- P17813
-