FDCSP antibody (Middle Region)
-
- Target See all FDCSP (C4orf7) Antibodies
- FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))
-
Binding Specificity
- AA 18-51, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FDCSP antibody is un-conjugated
-
Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.
- Sequence
- FPVSQDQERE KRSISDSDEL ASGFFVFPYP YPFR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.
Gene Name: follicular dendritic cell secreted protein
Protein Name: Follicular dendritic cell secreted peptide - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
- Isotype
- IgG
- Top Product
- Discover our top product C4orf7 Primary Antibody
-
-
- Application Notes
-
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- FDCSP (C4orf7) (Chromosome 4 Open Reading Frame 7 (C4orf7))
- Alternative Name
- FDCSP (C4orf7 Products)
- Synonyms
- FDC-SP antibody, C4orf7 antibody, cDNA sequence BC037156 antibody, follicular dendritic cell secreted protein antibody, BC037156 antibody, FDCSP antibody
- Background
-
FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
Synonyms: C4orf7 | FDC-SP | FDCSP | Q8NFU4 - Gene ID
- 260436
-