TMEM107 antibody (N-Term)
-
- Target See all TMEM107 products
- TMEM107 (Transmembrane Protein 107 (TMEM107))
-
Binding Specificity
- AA 22-57, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TMEM107 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Transmembrane protein 107(TMEM107) detection. Tested with WB, IHC-P in Human.
- Sequence
- VITLFWSRDS NIQACLPLTF TPEEYDKQDI QLVAAL
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Transmembrane protein 107(TMEM107) detection. Tested with WB, IHC-P in Human.
Gene Name: transmembrane protein 107
Protein Name: Transmembrane protein 107 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TMEM107 (Transmembrane Protein 107 (TMEM107))
- Alternative Name
- TMEM107 (TMEM107 Products)
- Synonyms
- zgc:77926 antibody, MGC157051 antibody, GRVS638 antibody, PRO1268 antibody, 1110004B13Rik antibody, 2810049P21Rik antibody, transmembrane protein 107 antibody, Transmembrane protein 107 antibody, transmembrane protein 107 L homeolog antibody, tmem107 antibody, TMEM107 antibody, Tmem107 antibody, Tsp_08866 antibody, tm107 antibody, tmem107.L antibody
- Background
-
Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of theTMEM107 sequence with the genomic sequence (GRCh38), the TMEM107 gene was mapped to chromosome 17p13.1.
Synonyms: DC20 | GRVS638 | PRO1268 | Tmem107 | UNQ638/PRO1268 | Q6UX40 - Gene ID
- 84314
-