FUS antibody

Catalog No. ABIN5518993

Product Details anti-FUS Antibody

Target: FUS (Fused in Sarcoma (FUS))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUS antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.

Sequence: DNNTIFVQGL GENVTIESVA DYFKQIGIIK TNKKT

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for TLS / FUS detection. Tested with WB in Human,Mouse,Rat.
Gene Name: FUS RNA binding protein
Protein Name: RNA-binding protein FUS

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence of human TLS / FUS (DNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKT).

Isotype: IgG

Application Details

Application Notes: Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for FUS

Target: FUS (Fused in Sarcoma (FUS))

Alternative Name: FUS (FUS Products)

Synonyms: ALS6 antibody, ETM4 antibody, FUS1 antibody, HNRNPP2 antibody, POMP75 antibody, TLS antibody, D430004D17Rik antibody, D930039C12Rik antibody, Fus1 antibody, Tls antibody, FUS/TLS antibody, FUS RNA binding protein antibody, fused in sarcoma antibody, FUS antibody, Fus antibody

Target Type: Viral Protein

Background: RNA-binding protein FUS/TLS (Fused in Sarcoma/Translocated in Sarcoma) is a protein that in humans is encoded by the FUS gene. This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Synonyms: RNA-binding protein FUS, 75 kDa DNA-pairing protein, Oncogene FUS, Oncogene TLS, POMp75, Translocated in liposarcoma protein, FUS, TLS

Gene ID: 2521

UniProt: P35637