Deleted In Azoospermia 4 (DAZ4) antibody

Details for Product No. ABIN5576431
Antigen
Reactivity
Human
52
19
19
4
3
3
2
2
2
2
Host
Rabbit
51
1
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
33
24
19
13
7
1
1
Options
Purpose Rabbit polyclonal antibody raised against synthetic peptide of human DAZ4.
Immunogen

immunogen: A synthetic peptide corresponding to N-terminus of human DAZ4.

Immunogen Sequence: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Cross-Reactivity Human
Antigen
Alternative Name DAZ4 (DAZ4 Antibody Abstract)
Background Full Gene Name: deleted in azoospermia 4
Synonyms: DAZ,DAZ1,pDP1680,pDP1681
Gene ID 57135
NCBI Accession NM_001005375
UniProt Q86SG3
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 μg/mL)
Western Blot (0.2-1 μg/mL)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS (2 % sucrose, 0.09 % sodium azide).
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Deleted In Azoospermia 4 (DAZ4) antibody (ABIN5576431) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kid...
Image no. 2 for anti-Deleted In Azoospermia 4 (DAZ4) antibody (ABIN5576431) Western Blot analysis of HepG2 cell lysate with DAZ4 polyclonal antibody at 0.2-1 ug...