TATDN3 antibody (TatD DNase Domain Containing 3) Primary Antibody
TATDN3
Reactivity: Human
IHC (p)
Host: Rabbit
Polyclonal
camera_alt 1
Catalog No. ABIN5589219
$577.33
Plus shipping costs $45.00
100 μL
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit polyclonal antibody raised against recombinant TATDN3.
- Cross-Reactivity
- Human
- Immunogen
immunogen: Recombinant protein corresponding to amino acids of human TATDN3.
Immunogen Sequence: AGVGLVDCHCHLSAPDFDRDLDDVLEKAKKANVVALVAVAEHSGEFEKIMQLSERYNGFVLPCL
- Isotype
- IgG
-
-
- Application Notes
- Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user. - Restrictions
- For Research Use only
-
- Format
- Liquid
- Buffer
- In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide)
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
- Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- TATDN3 (TATDN3 Antibody Abstract)
- Background
- Full Gene Name: TatD DNase domain containing 3
Synonyms: MGC142198 - Gene ID
- 128387
- UniProt
- Q17R31
You are here: