Protein Kinase Domain Containing, Cytoplasmic Homolog (Mouse) (PKDCC) antibody

Details for Product No. ABIN5650216
Antigen
  • SGK493
  • Vlk
  • AI115348
  • AW548124
  • Adtk1
  • ESTM17
  • MAd1
  • Sgk493
  • X83346
  • RGD1311939
  • protein kinase domain containing, cytoplasmic
  • PKDCC
  • Pkdcc
Reactivity
Human
14
6
6
Host
Rabbit
11
3
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
14
8
7
2
2
1
1
Options
Purpose Rabbit polyclonal antibody raised against partial recombinant human SGK493.
Immunogen

immunogen: Recombinant protein corresponding to human SGK493.

Immunogen Sequence: QDSEDIPDTLTTITELGAPVEMIQLLQTSWEDRFRICLSLGRLLHHLAHSPLGSVTLLDFRPRQFVLVDGELKVTDLD

Isotype IgG
Cross-Reactivity Human
Antigen
Alternative Name SGK493 (PKDCC Antibody Abstract)
Background Full Gene Name: protein kinase-like protein SgK493
Synonyms: FLJ18197,MGC125960
Gene ID 91461
UniProt Q504Y2
Application Notes Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Restrictions For Research Use only
Format Liquid
Buffer In PBS, pH 7.2 (40 % glycerol, 0.02 % sodium azide).
Storage 4 °C,-20 °C
Storage Comment Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protein Kinase Domain Containing, Cytoplasmic Homolog (Mouse) (PKDCC) antibody (ABIN5650216) Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human bon...
Did you look for something else?