BMP5 antibody (C-Term) (DyLight 488)

Catalog No. ABIN7354761

Product Details anti-BMP5 Antibody (DyLight 488)

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Binding Specificity: AA 332-365, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BMP5 antibody is conjugated to DyLight 488

Application: Flow Cytometry (FACS)

Sequence: HQDSSRMSSV GDYNTSEQKQ ACKKHELYVS FRDL

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG Polyclonal Anti-Human BMP5 Antibody DyLight® 488 Conjugated, Flow Validated.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Application Details

Application Notes:

Application Details: Flow Cytometry, 1-3 μg/1x10⁶ cells

Restrictions: For Research Use only

Handling

Format: Liquid

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C

Storage Comment: At 2-8°C for one year. Protect from light. Do not freeze.

References for anti-BMP5 antibody (DyLight 488) (ABIN7354761)

Wang, Xue, Zhao, Liu, Ma, Ma: "Form-deprivation myopia induces decreased expression of bone morphogenetic protein-2, 5 in guinea pig sclera." in: International journal of ophthalmology, Vol. 8, Issue 1, pp. 39-45, (2015) (PubMed).

Target Details for BMP5

Target: BMP5 (Bone Morphogenetic Protein 5 (BMP5))

Alternative Name: BMP5 (BMP5 Products)

Synonyms: bmp5l antibody, hm:zehl0669 antibody, zehl0669 antibody, zgc:64230 antibody, BMP5 antibody, AU023399 antibody, se antibody, bone morphogenetic protein 5 antibody, bmp5 antibody, BMP5 antibody, LOC100539495 antibody, Bmp5 antibody

Background:

Synonyms: Bone morphogenetic protein 5, BMP-5, BMP5

Tissue Specificity: Expressed in the lung and liver.

Background: Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

UniProt: P22003

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process