NR4A3 antibody

Catalog No. ABIN5692903

Product Details anti-NR4A3 Antibody

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR4A3 antibody is un-conjugated

Application: Western Blotting (WB)

Brand: Picoband™

Sequence: HDANTLYIFA PSPQSRDLWV KKLKEEIKNN NNIMIKYHPK

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Tec detection. Tested with WB in Human,Mouse,Rat.

Immunogen: A synthetic peptide corresponding to a sequence of human Tec (HDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPK).

Application Details

Application Notes:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C,-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Target Details for NR4A3

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Alternative Name: TEC (NR4A3 Products)

Synonyms: CHN antibody, CSMF antibody, MINOR antibody, NOR1 antibody, TEC antibody, AI573420 antibody, NOR-1 antibody, Nor1 antibody, NOR-2 antibody, NR4A3 antibody, Nr4a3 antibody, nuclear receptor subfamily 4 group A member 3 antibody, nuclear receptor subfamily 4, group A, member 3 antibody, NR4A3 antibody, Nr4a3 antibody, nr4a3 antibody

Background:

Synonyms: Tyrosine-protein kinase Tec, TEC, PSCTK4

Tissue Specificity: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.

Background: TEC (TEC Protein Tyrosine Kinase) is an enzyme that in humans is encoded by the TEC gene. The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. By fluorescence in situ hybridization, Sato et al. (1994) mapped the gene to 4p12, the same location reported for TXK. Mouse Tec is a non-receptor type protein-tyrosine kinase that is highly expressed in many hematopoietic cell lines. Hantschel et al. (2007) identified TEC kinase and BTK kinase as major binders of the tyrosine kinase inhibitor dasatinib, which is used for treatment of BCR/ABL-positive CML.

UniProt: P42680

Pathways: Fc-epsilon Receptor Signaling Pathway, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway