Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

14-3-3 zeta antibody

YWHAZ Reactivity: Human, Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN5708416
  • Target See all 14-3-3 zeta (YWHAZ) Antibodies
    14-3-3 zeta (YWHAZ)
    Reactivity
    • 135
    • 85
    • 69
    • 11
    • 10
    • 8
    • 8
    • 7
    • 5
    • 5
    • 4
    • 4
    • 3
    • 2
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 128
    • 7
    Rabbit
    Clonality
    • 129
    • 6
    Polyclonal
    Conjugate
    • 70
    • 10
    • 7
    • 6
    • 5
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This 14-3-3 zeta antibody is un-conjugated
    Application
    • 116
    • 58
    • 53
    • 30
    • 27
    • 22
    • 13
    • 13
    • 10
    • 7
    • 4
    • 3
    • 2
    • 1
    Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
    Purification
    Antigen affinity purified
    Immunogen
    Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ were used as the immunogen for the 14-3-3 zeta antibody.
    Isotype
    IgG
    Top Product
    Discover our top product YWHAZ Primary Antibody
  • Application Notes
    Optimal dilution of the 14-3-3 zeta antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL
    Restrictions
    For Research Use only
  • Buffer
    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
    Storage
    -20 °C
    Storage Comment
    After reconstitution, the 14-3-3 zeta antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target
    14-3-3 zeta (YWHAZ)
    Alternative Name
    14-3-3 zeta / YWHAZ (YWHAZ Products)
    Synonyms
    14-3-3-zeta antibody, KCIP-1 antibody, YWHAD antibody, 14-3-3zeta antibody, Ywhaz antibody, ACYPI003154 antibody, 14-3-3z antibody, kcip-1 antibody, ywhaq antibody, 1433z antibody, ywhaz antibody, ywhazb antibody, 1110013I11Rik antibody, AI596267 antibody, AL022924 antibody, AU020854 antibody, ywhaza antibody, fb14h09 antibody, wu:fb05g08 antibody, wu:fb14h09 antibody, ywhai antibody, zgc:55807 antibody, 14-3-3 antibody, 14-3-3 zeta antibody, 14-3-3ZETA antibody, 14-3-3leo antibody, 2G1 antibody, 4-3-3 zeta antibody, 5.11 antibody, 549 antibody, BEST:GH05075 antibody, CG17870 antibody, D14-3-3 antibody, D14-3-3zeta antibody, Dmel\\CG17870 antibody, K antibody, LEO antibody, Leo antibody, PAR-5 antibody, PAR5 antibody, Par-5 antibody, d14-3-3zeta antibody, l(2)07103 antibody, l(2)46CFe antibody, l(2)46Ee antibody, leo antibody, par-5 antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antibody, 14-3-3 protein zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antibody, 14-3-3 protein zeta/delta pseudogene antibody, CG17870 gene product from transcript CG17870-RE antibody, YWHAZ antibody, 14-3-3zeta antibody, ywhaz antibody, 1433z antibody, ywhaz.L antibody, Ywhaz antibody, ywhaz.S antibody, LOC100855903 antibody
    Background
    14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99 % identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.
    UniProt
    P63104
    Pathways
    Apoptosis, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
You are here:
Support