ATP5B antibody (N-Term)
-
- Target See all ATP5B Antibodies
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP5B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- ATP5 B antibody was raised against the N terminal of ATP5
- Purification
- Purified
- Immunogen
- ATP5 B antibody was raised using the N terminal of ATP5 corresponding to a region with amino acids PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ
- Top Product
- Discover our top product ATP5B Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP5B Blocking Peptide, catalog no. 33R-7154, is also available for use as a blocking control in assays to test for specificity of this ATP5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP5B (ATP Synthase, H+ Transporting, Mitochondrial F1 Complex, beta Polypeptide (ATP5B))
- Alternative Name
- ATP5B (ATP5B Products)
- Synonyms
- atpmb antibody, atpsb antibody, Atpsyn-beta antibody, hm:zehn0534 antibody, im:6793121 antibody, wu:fj38d01 antibody, zgc:111961 antibody, ATPMB antibody, ATPSB antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide antibody, ATP synthase subunit beta, mitochondrial antibody, ATP synthase, H+ transporting mitochondrial F1 complex, beta subunit antibody, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide S homeolog antibody, ATP5B antibody, atp5b antibody, Atp5b antibody, LOC100401662 antibody, LOC100635763 antibody, atp5b.S antibody
- Background
- ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-