LKB1 antibody (N-Term)

Catalog No. ABIN629708

Product Details anti-LKB1 Antibody

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LKB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: STK11 antibody was raised against the N terminal of STK11

Purification: Purified

Immunogen: STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STK11 Blocking Peptide, catalog no. 33R-9160, is also available for use as a blocking control in assays to test for specificity of this STK11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LKB1

Target: LKB1 (STK11) (serine/threonine Kinase 11 (STK11))

Alternative Name: STK11 (STK11 Products)

Synonyms: pjs antibody, LKB1 antibody, XEEK1 antibody, Stk11 antibody, PJS antibody, hLKB1 antibody, AA408040 antibody, Lkb1 antibody, Par-4 antibody, R75140 antibody, mLKB1 antibody, wu:fj61a05 antibody, zgc:110180 antibody, xeek1 antibody, serine/threonine kinase 11 antibody, polarization-related protein LKB1 antibody, serine/threonine kinase 11 L homeolog antibody, STK11 antibody, stk11 antibody, LOC662493 antibody, Stk11 antibody, stk11.L antibody

Background: STK11is a member of the serine/threonine kinase family, regulates cell polarity and functions as a tumor suppressor. Mutations in its gene have been associated with Peutz-Jeghers syndrome, an autosomal dominant disorder characterized by the growth of polyps in the gastrointestinal tract, pigmented macules on the skin and mouth, and other neoplasms.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Regulation of Carbohydrate Metabolic Process, Warburg Effect