ATP7A antibody

Catalog No. ABIN629724

Product Details anti-ATP7A Antibody

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATP7A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATP7A

Target: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Alternative Name: ATP7A (ATP7A Products)

Synonyms: ATP7A antibody, cal antibody, wu:fc43e01 antibody, zgc:153422 antibody, zgc:158633 antibody, DDBDRAFT_0218568 antibody, DDBDRAFT_0235190 antibody, DDB_0218568 antibody, DDB_0235190 antibody, atpase antibody, Atp7a antibody, kal antibody, atp7a antibody, DSMAX antibody, MK antibody, MNK antibody, SMAX3 antibody, Blo antibody, DXHXS1608e antibody, I14 antibody, Mo antibody, blotchy antibody, br antibody, brindled antibody, mottled antibody, Mnk antibody, ATPase copper transporting alpha antibody, ATPase, Cu++ transporting, alpha polypeptide antibody, P-type ATPase antibody, ATP synthase subunit a antibody, copper-transporting ATPase 1 antibody, ATP7A antibody, atp7a antibody, LOC100049514 antibody, Atp7a antibody, LOC412379 antibody

Background: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process