PPFIBP1 antibody
-
- Target See all PPFIBP1 Antibodies
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPFIBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
- Top Product
- Discover our top product PPFIBP1 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPFIBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPFIBP1 (PTPRF Interacting Protein, Binding Protein 1 (Liprin beta 1) (PPFIBP1))
- Alternative Name
- PPFIBP1 (PPFIBP1 Products)
- Synonyms
- liprin-beta-1 antibody, L2 antibody, SGT2 antibody, hSGT2 antibody, hSgt2p antibody, 4632409B19Rik antibody, AW214454 antibody, AW261454 antibody, PPFIA binding protein 1 antibody, PTPRF interacting protein, binding protein 1 (liprin beta 1) antibody, PTPRF interacting protein, binding protein 1 (liprin beta 1) S homeolog antibody, Ppfibp1 antibody, ppfibp1 antibody, ppfibp1.S antibody, PPFIBP1 antibody
- Background
- PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.
- Molecular Weight
- 19 kDa (MW of target protein)
-