UROD antibody (N-Term)

Catalog No. ABIN629827

Product Details anti-UROD Antibody

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UROD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: UROD antibody was raised against the N terminal of UROD

Purification: Purified

Immunogen: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UROD Blocking Peptide, catalog no. 33R-8607, is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UROD

Target: UROD (Uroporphyrinogen Decarboxylase (UROD))

Alternative Name: UROD (UROD Products)

Synonyms: UROD antibody, pct antibody, wu:fc43e09 antibody, PCT antibody, UPD antibody, AI323803 antibody, Uro-d antibody, porphyrinogen carboxy-lyase antibody, uroporphyrinogen decarboxylase antibody, Uroporphyrinogen decarboxylase UroD antibody, Uroporphyrinogen decarboxylase antibody, UROD antibody, urod antibody, hemE antibody, uroD antibody, Cpin_6502 antibody, Rmar_1187 antibody, LOC5568261 antibody, Mrub_1403 antibody, Arnit_2230 antibody, Ndas_2830 antibody, Mesil_2989 antibody, Trad_0222 antibody, Weevi_0432 antibody, Hipma_1229 antibody, Fluta_0529 antibody, Marky_1143 antibody, Halhy_5610 antibody, Mesop_0899 antibody, Ccan_20670 antibody, Urod antibody

Background: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Molecular Weight: 40 kDa (MW of target protein)