KYNU antibody
-
- Target See all KYNU Antibodies
- KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KYNU antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK
- Top Product
- Discover our top product KYNU Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KYNU Blocking Peptide, catalog no. 33R-5947, is also available for use as a blocking control in assays to test for specificity of this KYNU antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KYNU antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))
- Alternative Name
- KYNU (KYNU Products)
- Synonyms
- BA2753 antibody, 4432411A05Rik antibody, Kynureninase antibody, kynureninase antibody, kynureninase (L-kynurenine hydrolase) antibody, kynu-1 antibody, kynU antibody, CNC03980 antibody, Mrub_2118 antibody, Ndas_0787 antibody, Trad_2365 antibody, Ftrac_2835 antibody, Celal_2292 antibody, Deima_1563 antibody, Celly_0597 antibody, Deipr_2230 antibody, Fluta_1605 antibody, Halhy_3696 antibody, Mesop_4277 antibody, KYNU antibody, Kynu antibody
- Background
- Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.
- Molecular Weight
- 52 kDa (MW of target protein)
-