KYNU antibody

Catalog No. ABIN629834

The Rabbit Polyclonal anti-KYNU antibody is suitable to detect KYNU in samples from Human. It has been validated for WB.

Quick Overview for KYNU antibody (ABIN629834)

Target: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KYNU antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KYNU Antibody

Purification: Purified

Immunogen: KYNU antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KYNU Blocking Peptide, (ABIN5614400), is also available for use as a blocking control in assays to test for specificity of this KYNU antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KYNU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KYNU

Target: KYNU (Kynureninase (L-Kynurenine Hydrolase) (KYNU))

Alternative Name: KYNU

Background: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway.

Molecular Weight: 52 kDa (MW of target protein)