TPM2 antibody

Catalog No. ABIN629837

Product Details anti-TPM2 Antibody

Target: TPM2 (Tropomyosin-2 (TPM2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPM2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tropomyosin 2 Blocking Peptide, catalog no. 33R-1152, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPM2

Target: TPM2 (Tropomyosin-2 (TPM2))

Alternative Name: Tropomyosin 2 (TPM2 Products)

Synonyms: CG4843 antibody, DROTROPI1 antibody, Dmel\\CG4843 antibody, Ifm(3)3 antibody, Ifm(3)5 antibody, Ifm-TmI antibody, TM2 antibody, Tm antibody, Tm1 antibody, Tm127 antibody, TmI antibody, TmII antibody, Tn-H antibody, dro Tm antibody, l(3)nc99Eb antibody, mTmI antibody, cb836 antibody, fb68h02 antibody, tpm4l antibody, wu:fb68h02 antibody, wu:fj63f03 antibody, zgc:86810 antibody, AMCD1 antibody, DA1 antibody, DA2B antibody, TMSB antibody, nem4 antibody, tpm2 antibody, tpm2a antibody, BRT-2 antibody, TPM3 antibody, NEM4 antibody, Tpm-2 antibody, Trop-2 antibody, Tropomyosin 2 antibody, Tropomyosin-2 antibody, tropomyosin antibody, tropomyosin 2 (beta) antibody, tropomyosin 2 L homeolog antibody, tropomyosin 2 antibody, tropomyosin 2, beta antibody, Tm2 antibody, EDI_309330 antibody, LOC100101174 antibody, tpm2 antibody, tpm2.L antibody, TPM2 antibody, Tpm2 antibody

Background: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Molecular Weight: 33 kDa (MW of target protein)