TPM2 antibody
-
- Target See all TPM2 Antibodies
- TPM2 (Tropomyosin-2 (TPM2))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TPM2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
- Top Product
- Discover our top product TPM2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tropomyosin 2 Blocking Peptide, catalog no. 33R-1152, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPM2 (Tropomyosin-2 (TPM2))
- Alternative Name
- Tropomyosin 2 (TPM2 Products)
- Synonyms
- CG4843 antibody, DROTROPI1 antibody, Dmel\\CG4843 antibody, Ifm(3)3 antibody, Ifm(3)5 antibody, Ifm-TmI antibody, TM2 antibody, Tm antibody, Tm1 antibody, Tm127 antibody, TmI antibody, TmII antibody, Tn-H antibody, dro Tm antibody, l(3)nc99Eb antibody, mTmI antibody, cb836 antibody, fb68h02 antibody, tpm4l antibody, wu:fb68h02 antibody, wu:fj63f03 antibody, zgc:86810 antibody, AMCD1 antibody, DA1 antibody, DA2B antibody, TMSB antibody, nem4 antibody, tpm2 antibody, tpm2a antibody, BRT-2 antibody, TPM3 antibody, NEM4 antibody, Tpm-2 antibody, Trop-2 antibody, Tropomyosin 2 antibody, Tropomyosin-2 antibody, tropomyosin antibody, tropomyosin 2 (beta) antibody, tropomyosin 2 L homeolog antibody, tropomyosin 2 antibody, tropomyosin 2, beta antibody, Tm2 antibody, EDI_309330 antibody, LOC100101174 antibody, tpm2 antibody, tpm2.L antibody, TPM2 antibody, Tpm2 antibody
- Background
- The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.
- Molecular Weight
- 33 kDa (MW of target protein)
-