SRP19 antibody (Middle Region)
-
- Target See all SRP19 Antibodies
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SRP19 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SRP19 antibody was raised against the middle region of SRP19
- Purification
- Purified
- Immunogen
- SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
- Top Product
- Discover our top product SRP19 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SRP19 Blocking Peptide, catalog no. 33R-4826, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
- Alternative Name
- SRP19 (SRP19 Products)
- Synonyms
- 2310020D23Rik antibody, zgc:63961 antibody, CG4457 antibody, Dmel\\CG4457 antibody, SRP19 antibody, srp19 antibody, signal recognition particle 19 antibody, signal recognition particle 19kDa L homeolog antibody, signal recognition particle 19kDa antibody, Signal recognition particle protein 19 antibody, SRP19 antibody, srp19.L antibody, srp19 antibody, Srp19 antibody
- Background
- SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-