SFPQ antibody
-
- Target See all SFPQ Antibodies
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFPQ antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
- Top Product
- Discover our top product SFPQ Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFPQ Blocking Peptide, catalog no. 33R-9727, is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))
- Alternative Name
- SFPQ (SFPQ Products)
- Synonyms
- 1110004P21Rik antibody, 2810416M14Rik antibody, 5730453G22Rik antibody, 9030402K04Rik antibody, AU021830 antibody, D4Ertd314e antibody, Gm12940 antibody, OTTMUSG00000009329 antibody, PSF antibody, REP1 antibody, hm:zeh0027 antibody, wu:fa11h12 antibody, wu:fd10f03 antibody, zgc:85935 antibody, POMP100 antibody, splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated) antibody, splicing factor proline/glutamine-rich antibody, splicing factor proline and glutamine rich antibody, Sfpq antibody, sfpq antibody, SFPQ antibody
- Background
- SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.
- Molecular Weight
- 78 kDa (MW of target protein)
-