LSM2 antibody (LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae))

Details for Product anti-LSM2 Antibody No. ABIN630011, Supplier: Log in to see
Antigen
  • LSM2
  • 61.t00040
  • 18.m06211
  • 18.m06235
  • lsm2
  • C6orf28
  • G7B
  • YBL026W
  • snRNP
  • D17H6S56E-2
  • D17H6S56E2
  • Dmapl
  • Dmpkap
  • G7b
  • Sm-X5
  • SmX5
  • wu:fe48h10
  • zgc:101795
  • LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated
  • U6 snRNA-associated sm-like protein Lsm2, putative
  • u6 snRNA-associated sm-like protein lsm2
  • U6 snRNA-associated Sm-like protein LSm2
  • U6 snRNA-associated Sm-like protein LSm2, putative
  • u6 snRNA-associated sm-like protein Lsm2
  • U6 snRNA-associated sm-like protein Lsm2,putative
  • u6 snRNA-associated sm-like protein lsm2, putative
  • LSM2 homolog, U6 small nuclear RNA and mRNA degradation associated S homeolog
  • smx5
  • LSM2
  • PFE1020w
  • CNC01770
  • EHI_068580
  • PCHAS_123570
  • BBOV_II002620
  • BBOV_II002860
  • EBI_26471
  • Bm1_23515
  • PKH_101210
  • CGB_C2600W
  • lsm2
  • lsm2.S
  • Lsm2
  • smx5
Alternatives
anti-Cow (Bovine) LSM2 antibody for Immunohistochemistry
Reactivity
Human, Mouse (Murine), Rat (Rattus), Dog (Canine)
50
23
18
5
3
3
3
3
3
3
2
2
1
1
1
1
Host
Rabbit
25
15
10
Clonality
Polyclonal
Conjugate
This LSM2 antibody is un-conjugated
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
45
28
15
5
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen LSM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others LSM2 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name LSM2 (LSM2 Antibody Abstract)
Background Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.
Molecular Weight 10 kDa (MW of target protein)
Pathways Ribonucleoprotein Complex Subunit Organization
Application Notes WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

LSM2 Blocking Peptide, catalog no. 33R-9016, is also available for use as a blocking control in assays to test for specificity of this LSM2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Immunohistochemistry (IHC) image for anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody (ABIN630011) LSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Immunohistochemistry (IHC) image for anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody (ABIN630011) LSM2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to st...
Western Blotting (WB) image for anti-LSM2 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae) (LSM2) antibody (ABIN630011) LSM2 antibody used at 1.25 ug/ml to detect target protein.
Did you look for something else?