CHRNA7 antibody (Middle Region)
-
- Target See all CHRNA7 Antibodies
- CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHRNA7 antibody was raised against the middle region of CHRNA7
- Purification
- Purified
- Immunogen
- CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
- Top Product
- Discover our top product CHRNA7 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))
- Alternative Name
- CHRNA7 (CHRNA7 Products)
- Synonyms
- CHRNA7-2 antibody, NACHRA7 antibody, dZ70B1.1 antibody, Acra7 antibody, alpha7 antibody, BTX antibody, NARAD antibody, nAChRa7 antibody, CHRNA7 antibody, cholinergic receptor nicotinic alpha 7 subunit antibody, neuronal acetylcholine receptor subunit alpha-7 antibody, cholinergic receptor, nicotinic, alpha 7 (neuronal) antibody, cholinergic receptor, nicotinic, alpha polypeptide 7 antibody, cholinergic receptor, nicotinic, alpha 7 antibody, CHRNA7 antibody, LOC100374356 antibody, chrna7 antibody, Chrna7 antibody, LOC100060521 antibody
- Background
- The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-