CHRNA7 antibody (Middle Region)

Catalog No. ABIN630113

Product Details anti-CHRNA7 Antibody

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHRNA7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHRNA7 antibody was raised against the middle region of CHRNA7

Purification: Purified

Immunogen: CHRNA7 antibody was raised using the middle region of CHRNA7 corresponding to a region with amino acids VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHRNA7 Blocking Peptide, catalog no. 33R-9739, is also available for use as a blocking control in assays to test for specificity of this CHRNA7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHRNA7

Target: CHRNA7 (Cholinergic Receptor, Nicotinic, alpha 7 (Neuronal) (CHRNA7))

Alternative Name: CHRNA7 (CHRNA7 Products)

Synonyms: CHRNA7-2 antibody, NACHRA7 antibody, dZ70B1.1 antibody, Acra7 antibody, alpha7 antibody, BTX antibody, NARAD antibody, nAChRa7 antibody, CHRNA7 antibody, cholinergic receptor nicotinic alpha 7 subunit antibody, neuronal acetylcholine receptor subunit alpha-7 antibody, cholinergic receptor, nicotinic, alpha 7 (neuronal) antibody, cholinergic receptor, nicotinic, alpha polypeptide 7 antibody, cholinergic receptor, nicotinic, alpha 7 antibody, CHRNA7 antibody, LOC100374356 antibody, chrna7 antibody, Chrna7 antibody, LOC100060521 antibody

Background: The protein encoded by CHRNA7 displays marked permeability to calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to, alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene is located in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomal location involved in the genetic transmission of schizophrenia.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Synaptic Membrane