Glypican 3 antibody (Middle Region)
-
- Target See all Glypican 3 (GPC3) Antibodies
- Glypican 3 (GPC3)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Glypican 3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPC3 antibody was raised against the middle region of GPC3
- Purification
- Purified
- Immunogen
- GPC3 antibody was raised using the middle region of GPC3 corresponding to a region with amino acids FSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVL
- Top Product
- Discover our top product GPC3 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPC3 Blocking Peptide, catalog no. 33R-3080, is also available for use as a blocking control in assays to test for specificity of this GPC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Glypican 3 (GPC3)
- Alternative Name
- GPC3 (GPC3 Products)
- Synonyms
- GPC3 antibody, sgb antibody, dgsx antibody, sdys antibody, sgbs antibody, oci-5 antibody, sgbs1 antibody, DGSX antibody, GTR2-2 antibody, MXR7 antibody, OCI-5 antibody, SDYS antibody, SGB antibody, SGBS antibody, SGBS1 antibody, Glypican-3 antibody, glypican 3 antibody, gpc3 antibody, GPC3 antibody, Gpc3 antibody
- Background
- Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol linkage. These proteins may play a role in the control of cell division and growth regulation. Deletion mutations in this gene are associated with Simpson-Golabi-Behmel syndrome.
- Molecular Weight
- 64 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-