MCM5 antibody (N-Term)
-
- Target See all MCM5 Antibodies
- MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MCM5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MCM5 antibody was raised against the N terminal of MCM5
- Purification
- Purified
- Immunogen
- MCM5 antibody was raised using the N terminal of MCM5 corresponding to a region with amino acids MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG
- Top Product
- Discover our top product MCM5 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MCM5 Blocking Peptide, catalog no. 33R-6425, is also available for use as a blocking control in assays to test for specificity of this MCM5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MCM5 (Minichromosome Maintenance Complex Component 5 (MCM5))
- Alternative Name
- MCM5 (MCM5 Products)
- Synonyms
- 23.m06024 antibody, cdc46 antibody, xmcm5 antibody, CDC46 antibody, P1-CDC46 antibody, Afu5g02520 antibody, NCU01171.1 antibody, AA617332 antibody, AI324988 antibody, AL033333 antibody, Cdc46 antibody, Mcmd5 antibody, mCD46 antibody, mCDC46 antibody, mcm5 antibody, wu:fb34a06 antibody, CG4082 antibody, DmCDC46 antibody, DmCDC465 antibody, DmMCM5 antibody, DmMcm5 antibody, DmeMCM5 antibody, Dmel\\CG4082 antibody, MCM5 antibody, McM5 antibody, PCR4 antibody, DNA replication licensing factor MCM5 antibody, minichromosome maintenance complex component 5 S homeolog antibody, minichromosome maintenance complex component 5 antibody, DNA replication licensing factor Mcm5 antibody, DNA replication licensing factor mcm5 antibody, MCM5 minichromosome maintenance deficient 5 (S. cerevisiae) antibody, minichromosome maintenance complex component 5 L homeolog antibody, Minichromosome maintenance 5 antibody, DNA replication licensing factor mcm-5 antibody, BBOV_IV010040 antibody, mcm5.S antibody, MCM5 antibody, AFUA_5G02520 antibody, NCU01171 antibody, PVX_084615 antibody, LOC5576119 antibody, CpipJ_CPIJ008678 antibody, Bm1_24480 antibody, CMU_022890 antibody, Mcm5 antibody, mcm5 antibody, TP01_0722 antibody, mcm5.L antibody, mcm-5 antibody
- Background
- The protein encoded by MCM5 is structurally very similar to the CDC46 protein from S. cerevisiae, a protein involved in the initiation of DNA replication. The encoded protein is a member of the MCM family of chromatin-binding proteins and can interact with at least two other members of this family. The encoded protein is upregulated in the transition from the G0 to G1/S phase of the cell cycle and may actively participate in cell cycle regulation.
- Molecular Weight
- 82 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-