MSH2 antibody

Catalog No. ABIN630207

Product Details anti-MSH2 Antibody

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Reactivity: Human, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSH2 Blocking Peptide, catalog no. 33R-4562, is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSH2

Target: MSH2 (Mismatch Repair Protein 2 (MSH2))

Alternative Name: MSH2 (MSH2 Products)

Synonyms: COCA1 antibody, FCC1 antibody, HNPCC antibody, HNPCC1 antibody, LCFS2 antibody, AI788990 antibody, wu:fc06b02 antibody, wu:fc13e09 antibody, zgc:55333 antibody, ATMSH2 antibody, MUTS homolog 2 antibody, msh2 antibody, mutS homolog 2 antibody, mutS homolog 2 (E. coli) antibody, MUTS homolog 2 antibody, mutS homolog 2 L homeolog antibody, MutS protein homolog 2 antibody, MSH2 antibody, Msh2 antibody, msh2 antibody, msh2.L antibody

Background: MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response