BLK antibody (Middle Region)

Catalog No. ABIN630217

Product Details anti-BLK Antibody

Target: BLK (B Lymphoid Tyrosine Kinase (BLK))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BLK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BLK antibody was raised against the middle region of BLK

Purification: Purified

Immunogen: BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BLK

Target: BLK (B Lymphoid Tyrosine Kinase (BLK))

Alternative Name: BLK (BLK Products)

Synonyms: bltk antibody, si:dkey-33i22.2 antibody, zgc:136231 antibody, MODY11 antibody, BLK proto-oncogene, Src family tyrosine kinase antibody, B lymphoid kinase antibody, blk antibody, BLK antibody, Blk antibody

Background: BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling