BLK antibody (Middle Region)
-
- Target See all BLK Antibodies
- BLK (B Lymphoid Tyrosine Kinase (BLK))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BLK antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- BLK antibody was raised against the middle region of BLK
- Purification
- Purified
- Immunogen
- BLK antibody was raised using the middle region of BLK corresponding to a region with amino acids AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
- Top Product
- Discover our top product BLK Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BLK Blocking Peptide, catalog no. 33R-1621, is also available for use as a blocking control in assays to test for specificity of this BLK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLK (B Lymphoid Tyrosine Kinase (BLK))
- Alternative Name
- BLK (BLK Products)
- Synonyms
- bltk antibody, si:dkey-33i22.2 antibody, zgc:136231 antibody, MODY11 antibody, BLK proto-oncogene, Src family tyrosine kinase antibody, B lymphoid kinase antibody, blk antibody, BLK antibody, Blk antibody
- Background
- BLK may function in a signal transduction pathway that is restricted to B-lymphoid cells.
- Molecular Weight
- 58 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-