APCS antibody (N-Term)

Catalog No. ABIN630228

Product Details anti-APCS Antibody

Target: APCS (Amyloid P Component, Serum (APCS))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APCS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: APCS antibody was raised against the N terminal of APCS

Purification: Purified

Immunogen: APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APCS Blocking Peptide, catalog no. 33R-6691, is also available for use as a blocking control in assays to test for specificity of this APCS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APCS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APCS

Target: APCS (Amyloid P Component, Serum (APCS))

Alternative Name: APCS (APCS Products)

Synonyms: PTX2 antibody, SAP antibody, Sap antibody, APCS antibody, FP antibody, SAP(FP) antibody, apcs antibody, ptx2 antibody, sap antibody, amyloid P component, serum antibody, serum amyloid P-component antibody, amyloid P component, serum protein L homeolog antibody, APCS antibody, Apcs antibody, apcs.L antibody

Background: APCS is a glycoprotein, belonging to the pentraxin family of proteins, which has a characteristic pentameric organization. These family members have considerable sequence homology which is thought to be the result of gene duplication. The binding of the protein to proteins in the pathological amyloid cross-beta fold suggests its possible role as a chaperone. This protein is also thought to control the degradation of chromatin. It has been demonstrated that this protein binds to apoptotic cells at an early stage, which raises the possibility that it is involved in dealing with apoptotic cells in vivo.

Molecular Weight: 25 kDa (MW of target protein)