Annexin A3 antibody (N-Term)

Catalog No. ABIN630250

Product Details anti-Annexin A3 Antibody

Target: Annexin A3 (ANXA3)

Binding Specificity: N-Term

Reactivity: Chemical

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Annexin A3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Annexin A3 antibody was raised against the N terminal of ANXA3

Cross-Reactivity: Human

Purification: Purified

Immunogen: Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Annexin A3 Blocking Peptide, catalog no. 33R-5747, is also available for use as a blocking control in assays to test for specificity of this Annexin A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Annexin A3

Target: Annexin A3 (ANXA3)

Alternative Name: Annexin A3 (ANXA3 Products)

Synonyms: MGC80326 antibody, anxa3 antibody, zgc:101718 antibody, ANXA3 antibody, ANX3 antibody, Anx3 antibody, LC3 antibody, LRRGT00047 antibody, annexin A3 L homeolog antibody, annexin A3a antibody, annexin A3 antibody, Annexin A3 antibody, anxa3.L antibody, anxa3a antibody, ANXA3 antibody, anxa3 antibody, Anxa3 antibody

Target Type: Chemical

Background: The ANXA3 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions in the inhibition of phopholipase A2 and cleavage of inositol 1,2-cyclic phosphate to form inositol 1-phosphate. This protein may also play a role in anti-coagulation.

Molecular Weight: 36 kDa (MW of target protein)