PTK2B antibody (C-Term)

Catalog No. ABIN630279

Product Details anti-PTK2B Antibody

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PTK2B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PTK2 B antibody was raised against the C terminal of PTK2

Purification: Purified

Immunogen: PTK2 B antibody was raised using the C terminal of PTK2 corresponding to a region with amino acids QKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPR

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTK2B Blocking Peptide, catalog no. 33R-7611, is also available for use as a blocking control in assays to test for specificity of this PTK2B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PTK2B

Target: PTK2B (PTK2B Protein tyrosine Kinase 2 beta (PTK2B))

Alternative Name: PTK2B (PTK2B Products)

Synonyms: CADTK antibody, CAKB antibody, FADK2 antibody, FAK2 antibody, PKB antibody, PTK antibody, PYK2 antibody, RAFTK antibody, CAKbeta antibody, E430023O05Rik antibody, Raftk antibody, Pyk2 antibody, fak1b antibody, ptk2.2 antibody, ptk2b antibody, si:ch1073-355e8.1 antibody, protein tyrosine kinase 2 beta antibody, PTK2 protein tyrosine kinase 2 beta antibody, protein tyrosine kinase 2aa antibody, PTK2B antibody, Ptk2b antibody, ptk2aa antibody

Background: PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity.

Molecular Weight: 116 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization, Carbohydrate Homeostasis, Glycosaminoglycan Metabolic Process, Cellular Glucan Metabolic Process, Cell-Cell Junction Organization, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process, Hepatitis C, Protein targeting to Nucleus, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Signaling of Hepatocyte Growth Factor Receptor, Positive Regulation of fat Cell Differentiation, VEGF Signaling