CSH1 antibody
-
- Target See all CSH1 Antibodies
- CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSH1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- CSH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
- Top Product
- Discover our top product CSH1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSH1 Blocking Peptide, catalog no. 33R-8635, is also available for use as a blocking control in assays to test for specificity of this CSH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))
- Alternative Name
- CSH1 (CSH1 Products)
- Synonyms
- CS-1 antibody, CSA antibody, CSMT antibody, PL antibody, hCS-A antibody, CS-2 antibody, CSB antibody, hCS-B antibody, chorionic somatomammotropin hormone 1 antibody, chorionic somatomammotropin hormone 2 antibody, CSH1 antibody, CSH2 antibody
- Background
- CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
- Molecular Weight
- 24 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus
-