CSH1 antibody

Catalog No. ABIN630284

Product Details anti-CSH1 Antibody

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSH1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: CSH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSH1 Blocking Peptide, catalog no. 33R-8635, is also available for use as a blocking control in assays to test for specificity of this CSH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSH1

Target: CSH1 (Chorionic Somatomammotropin Hormone 1 (Placental Lactogen) (CSH1))

Alternative Name: CSH1 (CSH1 Products)

Synonyms: CS-1 antibody, CSA antibody, CSMT antibody, PL antibody, hCS-A antibody, CS-2 antibody, CSB antibody, hCS-B antibody, chorionic somatomammotropin hormone 1 antibody, chorionic somatomammotropin hormone 2 antibody, CSH1 antibody, CSH2 antibody

Background: CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.

Molecular Weight: 24 kDa (MW of target protein)

Pathways: Response to Growth Hormone Stimulus