Growth Hormone 2 antibody (Middle Region)
-
- Target See all Growth Hormone 2 (GH2) Antibodies
- Growth Hormone 2 (GH2)
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Growth Hormone 2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Growth Hormone 2 antibody was raised against the middle region of GH2
- Purification
- Purified
- Immunogen
- Growth Hormone 2 antibody was raised using the middle region of GH2 corresponding to a region with amino acids NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
- Top Product
- Discover our top product GH2 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Growth Hormone 2 Blocking Peptide, catalog no. 33R-6848, is also available for use as a blocking control in assays to test for specificity of this Growth Hormone 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Growth Hormone 2 (GH2)
- Alternative Name
- Growth Hormone 2 (GH2 Products)
- Synonyms
- GH-V antibody, GHL antibody, GHV antibody, hGH-V antibody, growth hormone 2 antibody, GH2 antibody
- Target Type
- Hormone
- Background
- GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
- Molecular Weight
- 22 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, JAK-STAT Signaling, Response to Growth Hormone Stimulus
-