Indian Hedgehog antibody

Catalog No. ABIN630306

Product Details anti-Indian Hedgehog Antibody

Target: Indian Hedgehog (IHH)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Indian Hedgehog antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IHH Blocking Peptide, catalog no. 33R-1064, is also available for use as a blocking control in assays to test for specificity of this IHH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IHH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Indian Hedgehog

Target: Indian Hedgehog (IHH)

Alternative Name: IHH (IHH Products)

Synonyms: BDA1 antibody, HHG2 antibody, X-hh antibody, Xbhh antibody, bhh antibody, bhh-a antibody, IHH antibody, ehh antibody, zgc:113262 antibody, indian hedgehog antibody, Indian hedgehog antibody, indian hedgehog S homeolog antibody, Indian hedgehog homolog b antibody, IHH antibody, Ihh antibody, ihh.S antibody, ihhb antibody

Background: IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Hedgehog Signaling