SLC22A2 antibody

Catalog No. ABIN630308

Product Details anti-SLC22A2 Antibody

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: SLC22 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A2 Blocking Peptide, catalog no. 33R-6311, is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A2

Target: SLC22A2 (Solute Carrier Family 22 (Organic Cation Transporter), Member 2 (SLC22A2))

Alternative Name: SLC22A2 (SLC22A2 Products)

Synonyms: OCT2 antibody, Oct2 antibody, Orct2 antibody, OCT2r antibody, rOCT2 antibody, Pou2f2 antibody, OCT2P antibody, oct1 antibody, wu:fc01b11 antibody, zgc:64076 antibody, slc22a2 antibody, solute carrier family 22 member 2 antibody, solute carrier family 22 (organic cation transporter), member 2 antibody, POU class 2 homeobox 2 antibody, solute carrier family 22 (organic cation transporter), member 2 L homeolog antibody, SLC22A2 antibody, Slc22a2 antibody, POU2F2 antibody, LOC521027 antibody, slc22a2 antibody, slc22a2.L antibody

Background: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Molecular Weight: 62 kDa (MW of target protein)