FLJ22167 (N-Term) antibody
-
- Target
- FLJ22167
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- Un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- FLJ22167 antibody was raised against the N terminal of FLJ22167
- Purification
- Purified
- Immunogen
- FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FLJ22167 Blocking Peptide, catalog no. 33R-1707, is also available for use as a blocking control in assays to test for specificity of this FLJ22167 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ22167 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ22167
- Background
- The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.
- Molecular Weight
- 36 kDa (MW of target protein)
-