UNC93B1 antibody
-
- Target See all UNC93B1 Antibodies
- UNC93B1 (Unc-93 Homolog B1 (UNC93B1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UNC93B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK
- Top Product
- Discover our top product UNC93B1 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UNC93B1 Blocking Peptide, catalog no. 33R-5095, is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UNC93B1 (Unc-93 Homolog B1 (UNC93B1))
- Alternative Name
- UNC93B1 (UNC93B1 Products)
- Synonyms
- UNC93 antibody, IIAE1 antibody, UNC93B antibody, Unc-93B1 antibody, Unc93b antibody, unc-93 homolog B1, TLR signaling regulator antibody, unc-93 homolog B1 (C. elegans) antibody, UNC93B1 antibody, Unc93b1 antibody
- Background
- UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- TLR Signaling, Activation of Innate immune Response, Toll-Like Receptors Cascades
-