FGG antibody (Middle Region)

Catalog No. ABIN630420

Product Details anti-FGG Antibody

Target: FGG (Fibrinogen gamma Chain (FGG))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGG antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FGG antibody was raised against the middle region of FGG

Purification: Purified

Immunogen: FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGG Blocking Peptide, catalog no. 33R-8054, is also available for use as a blocking control in assays to test for specificity of this FGG antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGG

Target: FGG (Fibrinogen gamma Chain (FGG))

Alternative Name: FGG (FGG Products)

Synonyms: FXII antibody, HAF antibody, 3010002H13Rik antibody, AI256424 antibody, fibrinogen antibody, FGG antibody, LOC100220680 antibody, fb60h05 antibody, fb62e01 antibody, wu:fb60h05 antibody, wu:fb62e01 antibody, zgc:56023 antibody, fibrinogen gamma chain antibody, coagulation factor XII (Hageman factor) antibody, fibrinogen gamma chain L homeolog antibody, FGG antibody, F12 antibody, fgg antibody, Fgg antibody, fgg.L antibody, CpipJ_CPIJ006387 antibody, CpipJ_CPIJ010087 antibody

Background: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.

Molecular Weight: 46 kDa (MW of target protein)