TGFBR2 antibody

Catalog No. ABIN630421

Product Details anti-TGFBR2 Antibody

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGFBR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: TGFBR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TGFBR2 Blocking Peptide, catalog no. 33R-6065, is also available for use as a blocking control in assays to test for specificity of this TGFBR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGFBR2

Target: TGFBR2 (Transforming Growth Factor, beta Receptor II (70/80kDa) (TGFBR2))

Alternative Name: TGFBR2 (TGFBR2 Products)

Synonyms: AAT3 antibody, FAA3 antibody, LDS1B antibody, LDS2B antibody, MFS2 antibody, RIIC antibody, TAAD2 antibody, TGFR-2 antibody, TGFbeta-RII antibody, 1110020H15Rik antibody, AU042018 antibody, DNIIR antibody, RIIDN antibody, TBR-II antibody, TbetaR-II antibody, TbetaRII antibody, TGFBR2 antibody, TBETA-RII antibody, TGFBRII antibody, TGF-beta 2 antibody, Tgfbr2T antibody, cb537 antibody, tgfbr2 antibody, wu:fj05c10 antibody, zgc:110498 antibody, transforming growth factor beta receptor 2 antibody, transforming growth factor, beta receptor II antibody, transforming growth factor, beta receptor 2 antibody, transforming growth factor beta receptor 2b antibody, TGFBR2 antibody, Tgfbr2 antibody, tgfbr2b antibody

Background: TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Molecular Weight: 62 kDa (MW of target protein)