CA4 antibody (Middle Region)
-
- Target See all CA4 Antibodies
- CA4 (Carbonic Anhydrase IV (CA4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Carbonic Anhydrase IV antibody was raised against the middle region of CA4
- Purification
- Purified
- Immunogen
- Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
- Top Product
- Discover our top product CA4 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Carbonic Anhydrase IV Blocking Peptide, catalog no. 33R-1946, is also available for use as a blocking control in assays to test for specificity of this Carbonic Anhydrase IV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CA4 (Carbonic Anhydrase IV (CA4))
- Alternative Name
- Carbonic Anhydrase IV (CA4 Products)
- Synonyms
- CAIV antibody, Car4 antibody, RP17 antibody, AW456718 antibody, Ca4 antibody, ca4 antibody, caiv antibody, car4 antibody, rp17 antibody, CA4 antibody, zgc:171842 antibody, carbonic anhydrase 4 antibody, carbonic anhydrase 4 S homeolog antibody, carbonic anhydrase IV a antibody, CA4 antibody, Car4 antibody, ca4 antibody, ca4.S antibody, Ca4 antibody, ca4a antibody
- Background
- Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.
- Molecular Weight
- 34 kDa (MW of target protein)
-