AADAC antibody

Catalog No. ABIN630448

Product Details anti-AADAC Antibody

Target: AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AADAC antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AADAC Blocking Peptide, catalog no. 33R-6939, is also available for use as a blocking control in assays to test for specificity of this AADAC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AADAC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AADAC

Target: AADAC (Arylacetamide Deacetylase (Esterase) (AADAC))

Alternative Name: AADAC (AADAC Products)

Synonyms: MGC89272 antibody, AADAC antibody, CES5A1 antibody, DAC antibody, Aada antibody, 5033417E09Rik antibody, AI265437 antibody, arylacetamide deacetylase antibody, arylacetamide deacetylase S homeolog antibody, Arylacetamide deacetylase antibody, arylacetamide deacetylase (esterase) antibody, LOC100056411 antibody, aadac antibody, AADAC antibody, aadac.S antibody, LOC100451808 antibody, ACD3 antibody, PTRG_10278 antibody, aaad antibody, Aadac antibody

Background: Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens.

Molecular Weight: 44 kDa (MW of target protein)