TSPAN32 antibody (Middle Region)
-
- Target See all TSPAN32 Antibodies
- TSPAN32 (Tetraspanin 32 (TSPAN32))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TSPAN32 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- Tetraspanin 32 antibody was raised against the middle region of TSPAN32
- Purification
- Purified
- Immunogen
- Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
- Top Product
- Discover our top product TSPAN32 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 32 Blocking Peptide, catalog no. 33R-10089, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSPAN32 (Tetraspanin 32 (TSPAN32))
- Alternative Name
- Tetraspanin 32 (TSPAN32 Products)
- Synonyms
- TSPAN32 antibody, ART1 antibody, PHEMX antibody, PHMX antibody, TSSC6 antibody, AW208513 antibody, Art-1 antibody, BB235973 antibody, D7Wsu37e antibody, Phemx antibody, Tssc6 antibody, tetraspanin 32 antibody, TSPAN32 antibody, Tspan32 antibody
- Background
- This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function.
- Molecular Weight
- 31 kDa (MW of target protein)
-