GBP4 antibody (Middle Region)
-
- Target See all GBP4 Antibodies
- GBP4 (Guanylate Binding Protein 4 (GBP4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GBP4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GBP4 antibody was raised against the middle region of GBP4
- Purification
- Affinity purified
- Immunogen
- GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE
- Top Product
- Discover our top product GBP4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GBP4 (Guanylate Binding Protein 4 (GBP4))
- Alternative Name
- GBP4 (GBP4 Products)
- Synonyms
- AW228052 antibody, Mag-2 antibody, Mpa-2 antibody, Mpa2 antibody, mKIAA4245 antibody, Gbp3 antibody, MGC108424 antibody, GBP4 antibody, Gbp4 antibody, si:ch211-250m6.1 antibody, si:dkey-61p9.3 antibody, gbp4 antibody, gbp4.L antibody, mpa2 antibody, guanylate binding protein 4 antibody, guanylate-binding protein 4-like antibody, guanylate-binding protein 4 antibody, guanylate binding protein 4 S homeolog antibody, Gbp4 antibody, GBP4 antibody, gbp4 antibody, GBP4L antibody, LOC612426 antibody, LOC100713243 antibody, gbp4.S antibody
- Background
- GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently, GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.
- Molecular Weight
- 45 kDa (MW of target protein)
-