GBP4 antibody (Middle Region)

Catalog No. ABIN630525

Product Details anti-GBP4 Antibody

Target: GBP4 (Guanylate Binding Protein 4 (GBP4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GBP4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GBP4 antibody was raised against the middle region of GBP4

Purification: Affinity purified

Immunogen: GBP4 antibody was raised using the middle region of GBP4 corresponding to a region with amino acids NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GBP4 Blocking Peptide, catalog no. 33R-6647, is also available for use as a blocking control in assays to test for specificity of this GBP4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GBP4

Target: GBP4 (Guanylate Binding Protein 4 (GBP4))

Alternative Name: GBP4 (GBP4 Products)

Synonyms: AW228052 antibody, Mag-2 antibody, Mpa-2 antibody, Mpa2 antibody, mKIAA4245 antibody, Gbp3 antibody, MGC108424 antibody, GBP4 antibody, Gbp4 antibody, si:ch211-250m6.1 antibody, si:dkey-61p9.3 antibody, gbp4 antibody, gbp4.L antibody, mpa2 antibody, guanylate binding protein 4 antibody, guanylate-binding protein 4-like antibody, guanylate-binding protein 4 antibody, guanylate binding protein 4 S homeolog antibody, Gbp4 antibody, GBP4 antibody, gbp4 antibody, GBP4L antibody, LOC612426 antibody, LOC100713243 antibody, gbp4.S antibody

Background: GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently, GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.

Molecular Weight: 45 kDa (MW of target protein)