PLSCR3 antibody (Middle Region)

Catalog No. ABIN630563

The Rabbit Polyclonal anti-PLSCR3 antibody is suitable to detect PLSCR3 in samples from Human. It has been validated for WB.

Quick Overview for PLSCR3 antibody (Middle Region) (ABIN630563)

Target: PLSCR3 (phospholipid Scramblase 3 (PLSCR3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLSCR3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLSCR3 Antibody

Binding Specificity: Middle Region

Specificity: PLSCR3 antibody was raised against the middle region of PLSCR3

Purification: Affinity purified

Immunogen: PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLSCR3 Blocking Peptide, (ABIN938573), is also available for use as a blocking control in assays to test for specificity of this PLSCR3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLSCR3

Target: PLSCR3 (phospholipid Scramblase 3 (PLSCR3))

Alternative Name: PLSCR3

Background: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Molecular Weight: 32 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis