PLSCR3 antibody (Middle Region)
-
- Target See all PLSCR3 Antibodies
- PLSCR3 (phospholipid Scramblase 3 (PLSCR3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLSCR3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLSCR3 antibody was raised against the middle region of PLSCR3
- Purification
- Affinity purified
- Immunogen
- PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV
- Top Product
- Discover our top product PLSCR3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLSCR3 Blocking Peptide, catalog no. 33R-3187, is also available for use as a blocking control in assays to test for specificity of this PLSCR3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLSCR3 (phospholipid Scramblase 3 (PLSCR3))
- Alternative Name
- PLSCR3 (PLSCR3 Products)
- Synonyms
- 2210403O21Rik antibody, 2610037N06Rik antibody, ESTM3 antibody, X83310 antibody, Pls3 antibody, zgc:77051 antibody, phospholipid scramblase 3 antibody, phospholipid scramblase 3b antibody, PLSCR3 antibody, Plscr3 antibody, plscr3b antibody
- Background
- PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr
- Molecular Weight
- 32 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis
-