Cardiac Troponin T2 antibody

Catalog No. ABIN630581

Product Details anti-Cardiac Troponin T2 Antibody

Target: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cardiac Troponin T2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Troponin T Type 2 Blocking Peptide, catalog no. 33R-2732, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cardiac Troponin T2

Target: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Abstract: cTnT Products

Synonyms: CMH2 antibody, CMPD2 antibody, LVNC6 antibody, RCM3 antibody, TnTC antibody, cTnT antibody, Tnt antibody, CTTG antibody, Ctt antibody, RATCTTG antibody, Tnnt3 antibody, tnnt2 antibody, CT3 antibody, si:ch211-136g2.1 antibody, troponin T2, cardiac type antibody, troponin T2, cardiac antibody, troponin T type 2a (cardiac) antibody, troponin T2, cardiac type L homeolog antibody, troponin T2e, cardiac antibody, TNNT2 antibody, Tnnt2 antibody, tnnt2a antibody, tnnt2.L antibody, tnnt2e antibody

Background: TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Molecular Weight: 35 kDa (MW of target protein)